PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_020783-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 269aa    MW: 30786.2 Da    PI: 5.4046
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_020783-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.61.6e-141461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd +l  ++k++G  +W+  +r  g+ R++k+c++rw +yl
    NNU_020783-RA 14 KGTWTPEEDMKLTAYIKRYGHWNWRELPRFAGLARCGKSCRLRWVNYL 61
                     799*****************99************************97 PP

2Myb_DNA-binding54.62.4e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg +++eEde++ + ++ lG++ W++Ia +++ gRt++++k++w++ 
    NNU_020783-RA  67 RGHFSPEEDEIIMKMHASLGNR-WTRIATKLP-GRTDNEIKNHWHTN 111
                      899*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.038961IPR017930Myb domain
SuperFamilySSF466899.54E-3011108IPR009057Homeodomain-like
SMARTSM007171.0E-101363IPR001005SANT/Myb domain
PfamPF002491.4E-121461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-231568IPR009057Homeodomain-like
CDDcd001672.27E-91661No hitNo description
PROSITE profilePS5129428.4162116IPR017930Myb domain
SMARTSM007174.9E-1666114IPR001005SANT/Myb domain
PfamPF002492.1E-1567111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-2669116IPR009057Homeodomain-like
CDDcd001671.68E-1170112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MAKTGYCEKT GLKKGTWTPE EDMKLTAYIK RYGHWNWREL PRFAGLARCG KSCRLRWVNY  60
LRPDIKRGHF SPEEDEIIMK MHASLGNRWT RIATKLPGRT DNEIKNHWHT NLKKRLNREP  120
TTASSNDKMH HNEELSECKS EGNNNTKESE PGTCLSDDPM DEIRSSPSTS QQSFGDLSSP  180
SIDYSSVITD TNWSKAADNV ASPENFAEPV CSFWTEPLLA GNSYIHEDFL ETTADPLMFP  240
LSLISFGDPF CGYEGFYNDD NFDVFNQLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-28121175109B-MYB
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010277888.10.0PREDICTED: myb-related protein 308-like
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.16e-61myb domain protein 14